Lineage for d1onob3 (1ono B:126-274)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 331066Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 331067Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 331255Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (5 proteins)
  6. 331256Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase [69770] (1 species)
  7. 331257Species Escherichia coli [TaxId:562] [69771] (5 PDB entries)
  8. 331264Domain d1onob3: 1ono B:126-274 [87164]
    Other proteins in same PDB: d1onoa1, d1onoa2, d1onob1, d1onob2
    complexed with mw3

Details for d1onob3

PDB Entry: 1ono (more details), 2.5 Å

PDB Description: IspC Mn2+ complex

SCOP Domain Sequences for d1onob3:

Sequence, based on SEQRES records: (download)

>d1onob3 d.81.1.3 (B:126-274) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli}
eslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyadleqngvvsilltg
sggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgleyiearwlfnasasq
mevlihpqsvihsmvryqdgsvlaqlgep

Sequence, based on observed residues (ATOM records): (download)

>d1onob3 d.81.1.3 (B:126-274) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli}
eslvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyadleqngvvsilltg
sggpfretplrdlatmtpdqacrkisvdsatmmnkgleyiearwlfnasasqmevlihpq
svihsmvryqdgsvlaqlgep

SCOP Domain Coordinates for d1onob3:

Click to download the PDB-style file with coordinates for d1onob3.
(The format of our PDB-style files is described here.)

Timeline for d1onob3: