SCOP 1.65: Domain d1on1a1: 1on1 A:2-62

Lineage for d1on1a1 (1on1 A:2-62)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (36 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.24: Iron-dependent represor protein [46882] (3 proteins)

6. Protein Manganese transport regulator MntR [88986] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [88987] (2 PDB entries)

8. Domain d1on1a1: 1on1 A:2-62 [87099]
   Other proteins in same PDB: d1on1a2, d1on1b2

Details for d1on1a1

PDB Entry: 1on1, 1.75 Å

PDB Description: Bacillus Subtilis Manganese Transport Regulator (Mntr) Bound To Manganese, AB Conformation.

SCOP Domain Sequences for d1on1a1:

Sequence, based on SEQRES records:

>d1on1a1 a.4.5.24 (A:2-62) Manganese transport regulator MntR {Bacillus subtilis}
ttpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglv
l

Sequence, based on observed residues (ATOM records):

>d1on1a1 a.4.5.24 (A:2-62) Manganese transport regulator MntR {Bacillus subtilis}
ttpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliglvl

Timeline for d1on1a1:

• d1on1a1 is new in SCOP 1.65
  
• d1on1a1 appears in SCOP 1.67
  
• d1on1a1 appears in the current release, SCOPe 2.08