Lineage for d1on1b1 (1on1 B:2-62)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 277521Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 277839Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (36 families) (S)
    contains a small beta-sheet (wing)
  5. 278129Family a.4.5.24: Iron-dependent represor protein [46882] (3 proteins)
  6. 278167Protein Manganese transport regulator MntR [88986] (1 species)
  7. 278168Species Bacillus subtilis [TaxId:1423] [88987] (2 PDB entries)
  8. 278172Domain d1on1b1: 1on1 B:2-62 [87101]
    Other proteins in same PDB: d1on1a2, d1on1b2
    complexed with mn

Details for d1on1b1

PDB Entry: 1on1 (more details), 1.75 Å

PDB Description: Bacillus Subtilis Manganese Transport Regulator (Mntr) Bound To Manganese, AB Conformation.

SCOP Domain Sequences for d1on1b1:

Sequence, based on SEQRES records: (download)

>d1on1b1 a.4.5.24 (B:2-62) Manganese transport regulator MntR {Bacillus subtilis}
ttpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglv
l

Sequence, based on observed residues (ATOM records): (download)

>d1on1b1 a.4.5.24 (B:2-62) Manganese transport regulator MntR {Bacillus subtilis}
ttpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliglvl

SCOP Domain Coordinates for d1on1b1:

Click to download the PDB-style file with coordinates for d1on1b1.
(The format of our PDB-style files is described here.)

Timeline for d1on1b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1on1b2