SCOPe 2.03: Domain d1on0c_: 1on0 C:

Lineage for d1on0c_ (1on0 C:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)

6. Protein Putative acetyltransferase YycN [90011] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [90012] (2 PDB entries)

8. Domain d1on0c_: 1on0 C: [87097]
   structural genomics; target SR144
   complexed with cl, so4

Details for d1on0c_

PDB Entry: 1on0, 2.2 Å

PDB Description: crystal structure of putative acetyltransferase (yycn) from bacillus subtilis, northeast structural genomics consortium target sr144

PDB Compounds: (C:) YycN protein

SCOPe Domain Sequences for d1on0c_:

Sequence; same for both SEQRES and ATOM records:

>d1on0c_ d.108.1.1 (C:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]}
timltpmqteefrsyltyttkhyaeekvkagtwlpedaqllskqvftdllprgletphhh
lwslklnekdivgwlwihaepehpqqeafiydfglyepyrgkgyakqalaaldqaarsmg
irklslhvfahnqtarklyeqtgfqetdvvmskkll

Timeline for d1on0c_:

• d1on0c_ first appeared in SCOP 1.65
  
• d1on0c_ appears in SCOPe 2.02
  
• d1on0c_ appears in SCOPe 2.04
  
• d1on0c_ appears in the current release, SCOPe 2.08, called d1on0c1