Lineage for d1on0a_ (1on0 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1426873Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1426874Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1426875Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 1427177Protein Putative acetyltransferase YycN [90011] (1 species)
  7. 1427178Species Bacillus subtilis [TaxId:1423] [90012] (2 PDB entries)
  8. 1427181Domain d1on0a_: 1on0 A: [87095]
    structural genomics; target SR144
    complexed with cl, so4

Details for d1on0a_

PDB Entry: 1on0 (more details), 2.2 Å

PDB Description: crystal structure of putative acetyltransferase (yycn) from bacillus subtilis, northeast structural genomics consortium target sr144
PDB Compounds: (A:) YycN protein

SCOPe Domain Sequences for d1on0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1on0a_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]}
timltpmqteefrsyltyttkhyaeekvkagtwlpedaqllskqvftdllprgletphhh
lwslklnekdivgwlwihaepehpqqeafiydfglyepyrgkgyakqalaaldqaarsmg
irklslhvfahnqtarklyeqtgfqetdvvmskkll

SCOPe Domain Coordinates for d1on0a_:

Click to download the PDB-style file with coordinates for d1on0a_.
(The format of our PDB-style files is described here.)

Timeline for d1on0a_: