Lineage for d1omwg_ (1omw G:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 286285Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (9 superfamilies)
    not a true fold
  4. 286317Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) (S)
    long alpha-helix interrupted in the middle
  5. 286318Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (1 protein)
  6. 286319Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species)
  7. 286320Species Cow (Bos taurus) [TaxId:9913] [48673] (9 PDB entries)
  8. 286328Domain d1omwg_: 1omw G: [87090]
    Other proteins in same PDB: d1omwa1, d1omwa2, d1omwa3, d1omwb_
    complexed with cmt; mutant

Details for d1omwg_

PDB Entry: 1omw (more details), 2.5 Å

PDB Description: crystal structure of the complex between g protein-coupled receptor kinase 2 and heterotrimeric g protein beta 1 and gamma 2 subunits

SCOP Domain Sequences for d1omwg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1omwg_ a.137.3.1 (G:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus)}
siaqarklveqlkmeanidrikvskaaadlmayceahakedplltpvpasenpfrekkff
c

SCOP Domain Coordinates for d1omwg_:

Click to download the PDB-style file with coordinates for d1omwg_.
(The format of our PDB-style files is described here.)

Timeline for d1omwg_: