Lineage for d1okeb2 (1oke B:1-297)

  1. Root: SCOP 1.65
  2. 340091Class f: Membrane and cell surface proteins and peptides [56835] (36 folds)
  3. 340391Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
    2 intertwined domains; all-beta and alpha+beta
  4. 340392Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (1 family) (S)
  5. 340393Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (2 proteins)
  6. 340394Protein Envelope glycoprotein [56985] (2 species)
  7. 340395Species Dengue virus type 2 [TaxId:12637] [90131] (2 PDB entries)
  8. 340397Domain d1okeb2: 1oke B:1-297 [87057]
    Other proteins in same PDB: d1okea1, d1okeb1
    complexed with afl, bma, bog, nag

Details for d1okeb2

PDB Entry: 1oke (more details), 2.4 Å

PDB Description: crystal structure of the dengue 2 virus envelope protein in complex with n-octyl-beta-d-glucoside

SCOP Domain Sequences for d1okeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1okeb2 f.10.1.1 (B:1-297) Envelope glycoprotein {Dengue virus type 2}
mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc
ieakltntttesrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamft
ckknmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygt
vtmecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf
knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgm

SCOP Domain Coordinates for d1okeb2:

Click to download the PDB-style file with coordinates for d1okeb2.
(The format of our PDB-style files is described here.)

Timeline for d1okeb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1okeb1