Class f: Membrane and cell surface proteins and peptides [56835] (36 folds) |
Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily) 2 intertwined domains; all-beta and alpha+beta |
Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (1 family) |
Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (2 proteins) |
Protein Envelope glycoprotein [56985] (2 species) |
Species Dengue virus type 2 [TaxId:12637] [90131] (2 PDB entries) |
Domain d1okeb2: 1oke B:1-297 [87057] Other proteins in same PDB: d1okea1, d1okeb1 complexed with afl, bma, bog, nag |
PDB Entry: 1oke (more details), 2.4 Å
SCOP Domain Sequences for d1okeb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1okeb2 f.10.1.1 (B:1-297) Envelope glycoprotein {Dengue virus type 2} mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc ieakltntttesrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamft ckknmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygt vtmecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgm
Timeline for d1okeb2: