Lineage for d1ohhd3 (1ohh D:82-357)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 582685Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (15 proteins)
    core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest
  6. 582783Protein Central domain of beta subunit of F1 ATP synthase [88779] (4 species)
  7. 582786Species Cow (Bos taurus) [TaxId:9913] [88780] (12 PDB entries)
  8. 582817Domain d1ohhd3: 1ohh D:82-357 [87026]
    Other proteins in same PDB: d1ohha1, d1ohha2, d1ohha3, d1ohhb1, d1ohhb2, d1ohhb3, d1ohhc1, d1ohhc2, d1ohhc3, d1ohhd1, d1ohhd2, d1ohhe1, d1ohhe2, d1ohhf1, d1ohhf2, d1ohhg_, d1ohhh_

Details for d1ohhd3

PDB Entry: 1ohh (more details), 2.8 Å

PDB Description: bovine mitochondrial f1-atpase complexed with the inhibitor protein if1

SCOP Domain Sequences for d1ohhd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ohhd3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Cow (Bos taurus)}
iripvgpetlgrimnvigepidergpiktkqfaaihaeapefvemsveqeilvtgikvvd
llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi
esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf
tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa
pattfahldattvlsraiaelgiypavdpldstsri

SCOP Domain Coordinates for d1ohhd3:

Click to download the PDB-style file with coordinates for d1ohhd3.
(The format of our PDB-style files is described here.)

Timeline for d1ohhd3: