Lineage for d1ohha1 (1ohh A:380-510)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 540119Fold a.69: Left-handed superhelix [47916] (3 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 540120Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (1 family) (S)
  5. 540121Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)
  6. 540122Protein F1 ATP synthase alpha subunit, domain 3 [88886] (4 species)
  7. 540125Species Cow (Bos taurus) [TaxId:9913] [88893] (12 PDB entries)
  8. 540156Domain d1ohha1: 1ohh A:380-510 [87015]
    Other proteins in same PDB: d1ohha2, d1ohha3, d1ohhb2, d1ohhb3, d1ohhc2, d1ohhc3, d1ohhd1, d1ohhd2, d1ohhd3, d1ohhe1, d1ohhe2, d1ohhe3, d1ohhf1, d1ohhf2, d1ohhf3, d1ohhg_, d1ohhh_

Details for d1ohha1

PDB Entry: 1ohh (more details), 2.8 Å

PDB Description: bovine mitochondrial f1-atpase complexed with the inhibitor protein if1

SCOP Domain Sequences for d1ohha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ohha1 a.69.1.1 (A:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus)}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke
ivtnflagfea

SCOP Domain Coordinates for d1ohha1:

Click to download the PDB-style file with coordinates for d1ohha1.
(The format of our PDB-style files is described here.)

Timeline for d1ohha1: