SCOPe 2.02: Domain d1ofuy_: 1ofu Y:

Lineage for d1ofuy_ (1ofu Y:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.22: Bacterial cell division inhibitor SulA [89678] (1 protein)
   homologous to RecA but lacks its P-loop motif; the fold is C-terminally truncated; 5-stranded parallel beta-sheet, order: 15423

6. Protein Hypothetical protein PA3008 [89679] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [89680] (2 PDB entries)

8. Domain d1ofuy_: 1ofu Y: [86977]
   Other proteins in same PDB: d1ofua1, d1ofua2, d1ofub1, d1ofub2
   complexed with FtsZ
   complexed with gdp

Details for d1ofuy_

PDB Entry: 1ofu, 2.1 Å

PDB Description: crystal structure of sula:ftsz from pseudomonas aeruginosa

PDB Compounds: (Y:) hypothetical protein pa3008

SCOPe Domain Sequences for d1ofuy_:

Sequence; same for both SEQRES and ATOM records:

>d1ofuy_ c.37.1.22 (Y:) Hypothetical protein PA3008 {Pseudomonas aeruginosa [TaxId: 287]}
paafselslsglpghcltllapilrelseeqdarwltliappaslthewlrraglnreri
lllqakdnaaalalscealrlgrshtvvswleplsraarkqlsraaqlgqaqslnirlg

Timeline for d1ofuy_:

• d1ofuy_ first appeared in SCOP 1.65
  
• d1ofuy_ appears in SCOPe 2.01
  
• d1ofuy_ appears in SCOPe 2.03
  
• d1ofuy_ appears in the current release, SCOPe 2.08