SCOP 1.69: Domain d1oftd_: 1oft D:

Lineage for d1oftd_ (1oft D:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.22: Bacterial cell division inhibitor SulA [89678] (1 protein)
   homologous to RecA but lacks its P-loop motif; the fold is C-terminally truncated; 5-stranded parallel beta-sheet, order: 15423

6. Protein Hypothetical protein PA3008 [89679] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [89680] (2 PDB entries)

8. Domain d1oftd_: 1oft D: [86971]

Details for d1oftd_

PDB Entry: 1oft, 2.9 Å

PDB Description: crystal structure of sula from pseudomonas aeruginosa

SCOP Domain Sequences for d1oftd_:

Sequence; same for both SEQRES and ATOM records:

>d1oftd_ c.37.1.22 (D:) Hypothetical protein PA3008 {Pseudomonas aeruginosa}
paafselslsglpghcltllapilrelseeqdarwltliappaslthewlrraglnreri
lllqakdnaaalalscealrlgrshtvvswleplsraarkqlsraaqlgqaqslnirlg

Timeline for d1oftd_:

• d1oftd_ first appeared in SCOP 1.65
  
• d1oftd_ appears in SCOP 1.67
  
• d1oftd_ appears in SCOP 1.71
  
• d1oftd_ appears in the current release, SCOPe 2.08