Lineage for d1oftd_ (1oft D:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 313180Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 313181Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) (S)
    division into families based on beta-sheet topologies
  5. 314720Family c.37.1.22: Bacterial cell division inhibitor SulA [89678] (1 protein)
    homologous to RecA but lacks its P-loop motif; the fold is C-terminally truncated; 5-stranded parallel beta-sheet, order: 15423
  6. 314721Protein Hypothetical protein PA3008 [89679] (1 species)
  7. 314722Species Pseudomonas aeruginosa [TaxId:287] [89680] (2 PDB entries)
  8. 314728Domain d1oftd_: 1oft D: [86971]

Details for d1oftd_

PDB Entry: 1oft (more details), 2.9 Å

PDB Description: crystal structure of sula from pseudomonas aeruginosa

SCOP Domain Sequences for d1oftd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oftd_ c.37.1.22 (D:) Hypothetical protein PA3008 {Pseudomonas aeruginosa}
paafselslsglpghcltllapilrelseeqdarwltliappaslthewlrraglnreri
lllqakdnaaalalscealrlgrshtvvswleplsraarkqlsraaqlgqaqslnirlg

SCOP Domain Coordinates for d1oftd_:

Click to download the PDB-style file with coordinates for d1oftd_.
(The format of our PDB-style files is described here.)

Timeline for d1oftd_: