Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein HslV (ClpQ) protease [56258] (4 species) dodecameric prokaryotic homologue of proteasome |
Species Haemophilus influenzae [TaxId:727] [56260] (6 PDB entries) |
Domain d1ofhi_: 1ofh I: [86953] Other proteins in same PDB: d1ofha_, d1ofhb_, d1ofhc_ complexed with adp, mg, po4 |
PDB Entry: 1ofh (more details), 2.5 Å
SCOPe Domain Sequences for d1ofhi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ofhi_ d.153.1.4 (I:) HslV (ClpQ) protease {Haemophilus influenzae [TaxId: 727]} ttivsvrrngqvvvggdgqvslgntvmkgnarkvrrlyngkvlagfaggtadaftlfelf erklemhqghllksavelakdwrtdralrkleamlivadekesliitgigdvvqpeedqi laigsggnyalsaaralventelsaheivekslriagdicvftntnftieelpn
Timeline for d1ofhi_: