Lineage for d1ofda1 (1ofd A:1240-1507)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 962283Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 962474Superfamily b.80.4: Alpha subunit of glutamate synthase, C-terminal domain [69336] (1 family) (S)
  5. 962475Family b.80.4.1: Alpha subunit of glutamate synthase, C-terminal domain [69337] (1 protein)
    this is a repeat family; one repeat unit is 1ea0 A:1280-1300 found in domain
  6. 962476Protein Alpha subunit of glutamate synthase, C-terminal domain [69338] (2 species)
    Central domain (residues 423-780) may be a rudiment form of the FMN domain
  7. 962486Species Synechocystis sp. [TaxId:1143] [75027] (5 PDB entries)
  8. 962487Domain d1ofda1: 1ofd A:1240-1507 [86935]
    Other proteins in same PDB: d1ofda2, d1ofda3, d1ofdb2, d1ofdb3
    complexed with akg, f3s, fmn

Details for d1ofda1

PDB Entry: 1ofd (more details), 2 Å

PDB Description: glutamate synthase from synechocystis sp in complex with 2-oxoglutarate at 2.0 angstrom resolution
PDB Compounds: (A:) ferredoxin-dependent glutamate synthase 2

SCOPe Domain Sequences for d1ofda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ofda1 b.80.4.1 (A:1240-1507) Alpha subunit of glutamate synthase, C-terminal domain {Synechocystis sp. [TaxId: 1143]}
vhsngpvldddiladpdiqeainhqttatktyrlvntdrtvgtrlsgaiakkygnngfeg
nitlnfqgaagqsfgafnldgmtlhlqgeandyvgkgmnggeivivphpqasfapednvi
igntclygatggnlyangragerfavrnsvgkaviegagdhcceymtggvivvlgpvgrn
vgagmtgglayfldevgdlpekinpeiitlqritaskgeeqlkslitahvehtgspkgka
ilanwsdylgkfwqavppsekdspeann

SCOPe Domain Coordinates for d1ofda1:

Click to download the PDB-style file with coordinates for d1ofda1.
(The format of our PDB-style files is described here.)

Timeline for d1ofda1: