SCOPe 2.05: Domain d1of3b_: 1of3 B:

Lineage for d1of3b_ (1of3 B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.18: Family 27 carbohydrate binding module, CBM27 [89241] (2 proteins)

6. Protein Beta-mannosidase, C-terminal domain [89242] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [89243] (3 PDB entries)

8. Domain d1of3b_: 1of3 B: [86931]
   complexed with ca

Details for d1of3b_

PDB Entry: 1of3, 2 Å

PDB Description: structural and thermodynamic dissection of specific mannan recognition by a carbohydrate-binding module, tmcbm27

PDB Compounds: (B:) beta-mannosidase

SCOPe Domain Sequences for d1of3b_:

Sequence; same for both SEQRES and ATOM records:

>d1of3b_ b.18.1.18 (B:) Beta-mannosidase, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
snearyvlaeevdfsspeevknwwnsgtwqaefgspdiewngevgngalqlnvklpgksd
weevrvarkferlseceileydiyipnveglkgrlrpyavlnpgwvkigldmnnanvesa
eiitfggkeyrrfhvriefdrtagvkelhigvvgdhlrydgpifidnvrlykrt

Timeline for d1of3b_:

• d1of3b_ first appeared in SCOP 1.65
  
• d1of3b_ appears in SCOPe 2.04
  
• d1of3b_ appears in SCOPe 2.06
  
• d1of3b_ appears in the current release, SCOPe 2.08