Class b: All beta proteins [48724] (180 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.18: Family 27 carbohydrate binding module, CBM27 [89241] (2 proteins) |
Protein Beta-mannosidase, C-terminal domain [89242] (1 species) |
Species Thermotoga maritima [TaxId:2336] [89243] (3 PDB entries) |
Domain d1of3b_: 1of3 B: [86931] complexed with ca |
PDB Entry: 1of3 (more details), 2 Å
SCOPe Domain Sequences for d1of3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1of3b_ b.18.1.18 (B:) Beta-mannosidase, C-terminal domain {Thermotoga maritima [TaxId: 2336]} snearyvlaeevdfsspeevknwwnsgtwqaefgspdiewngevgngalqlnvklpgksd weevrvarkferlseceileydiyipnveglkgrlrpyavlnpgwvkigldmnnanvesa eiitfggkeyrrfhvriefdrtagvkelhigvvgdhlrydgpifidnvrlykrt
Timeline for d1of3b_: