SCOP 1.71: Domain d1oeta_: 1oet A:

Lineage for d1oeta_ (1oet A:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (4 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (6 proteins)
   has an extension to the beta-sheet of 3 antiparallel strands before strand 4

6. Protein Tyrosine phosphatase [52806] (7 species)

7. Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (63 PDB entries)

8. Domain d1oeta_: 1oet A: [86921]
   complexed with cea, mg

Details for d1oeta_

PDB Entry: 1oet, 2.3 Å

PDB Description: oxidation state of protein tyrosine phosphatase 1b

SCOP Domain Sequences for d1oeta_:

Sequence; same for both SEQRES and ATOM records:

>d1oeta_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), 1B}
emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd
fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdp
ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfim

Timeline for d1oeta_:

• d1oeta_ first appeared in SCOP 1.65
  
• d1oeta_ appears in SCOP 1.69
  
• d1oeta_ appears in SCOP 1.73
  
• d1oeta_ appears in the current release, SCOPe 2.08