Lineage for d1od9a_ (1od9 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1512485Protein N-terminal domain of sialoadhesin [48732] (1 species)
  7. 1512486Species Mouse (Mus musculus) [TaxId:10090] [48733] (6 PDB entries)
    Uniprot Q62230 20-130
  8. 1512490Domain d1od9a_: 1od9 A: [86839]
    complexed with bnd, so4

Details for d1od9a_

PDB Entry: 1od9 (more details), 2.1 Å

PDB Description: n-terminal of sialoadhesin in complex with me-a-9-n-benzoyl-amino-9- deoxy-neu5ac (benz compound)
PDB Compounds: (A:) sialoadhesin

SCOPe Domain Sequences for d1od9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1od9a_ b.1.1.1 (A:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]}
twgvsspknvqglsgscllipcifsypadvpvsngitaiwyydysgkrqvvihsgdpklv
dkrfrgraelmgnmdhkvcnlllkdlkpedsgtynfrfeisdsnrwldvkgttvtvttd

SCOPe Domain Coordinates for d1od9a_:

Click to download the PDB-style file with coordinates for d1od9a_.
(The format of our PDB-style files is described here.)

Timeline for d1od9a_: