SCOPe 2.01: Domain d1ocla_: 1ocl A:

Lineage for d1ocla_ (1ocl A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.117: Amidase signature (AS) enzymes [75303] (1 superfamily)
   possible duplication: the topologies of N- and C-terminal halves are similar; 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213549A867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.117.1: Amidase signature (AS) enzymes [75304] (1 family)

5. Family c.117.1.1: Amidase signature (AS) enzymes [75305] (5 proteins)

6. Protein Malonamidase E2 [75306] (1 species)

7. Species Bradyrhizobium japonicum [TaxId:375] [75307] (12 PDB entries)

8. Domain d1ocla_: 1ocl A: [86804]
   complexed with mla

Details for d1ocla_

PDB Entry: 1ocl, 2 Å

PDB Description: the crystal structure of malonamidase e2 complexed with malonate from bradyrhizobium japonicum

PDB Compounds: (A:) malonamidase e2

SCOPe Domain Sequences for d1ocla_:

Sequence; same for both SEQRES and ATOM records:

>d1ocla_ c.117.1.1 (A:) Malonamidase E2 {Bradyrhizobium japonicum [TaxId: 375]}
misladlqrrietgelspnaaiaqshaaiearekevhafvrhdksaraqasgplrgiavg
ikdiidtanmptemgseiyrgwqprsdapvvmmlkragatiigkttttafasrdptatln
phntghspggsssgsaaavgagmiplalgtqtggsvirpaaycgtaaikpsfrmlptvgv
kcyswaldtvglfgaraedlargllamtgrsefsgivpakaprigvvrqefagavepaae
qglqaaikaaeragasvqaidlpeavheawrihpiiqdfeahralawefsehhdeiapml
rasldatvgltpkeydearrigrrgrrelgevfegvdvlltysapgtapakalastgdpr
ynrlwtlmgnpcvnvpvlkvgglpigvqviarfgndahalatawfledalak

Timeline for d1ocla_:

• d1ocla_ first appeared in SCOP 1.65
  
• d1ocla_ appears in SCOP 1.75
  
• d1ocla_ appears in SCOPe 2.02
  
• d1ocla_ appears in the current release, SCOPe 2.08