Class b: All beta proteins [48724] (180 folds) |
Fold b.51: ValRS/IleRS/LeuRS editing domain [50676] (1 superfamily) core: barrel, closed; n=6, S=8; topology is similar to that of the acid proteases barrel |
Superfamily b.51.1: ValRS/IleRS/LeuRS editing domain [50677] (1 family) |
Family b.51.1.1: ValRS/IleRS/LeuRS editing domain [50678] (4 proteins) inserted into the catalytic domain |
Protein Leucyl-tRNA synthetase (LeuRS) [82133] (1 species) in the prokaryotic and mitochondrial LeuRS this domain is inserted into a different sequential position |
Species Thermus thermophilus [TaxId:274] [82134] (3 PDB entries) |
Domain d1obha2: 1obh A:226-417 [86774] Other proteins in same PDB: d1obha1, d1obha3 protein/RNA complex; complexed with hg, lms, nva, so4 |
PDB Entry: 1obh (more details), 2.2 Å
SCOPe Domain Sequences for d1obha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1obha2 b.51.1.1 (A:226-417) Leucyl-tRNA synthetase (LeuRS) {Thermus thermophilus [TaxId: 274]} rsegaeilfpvegkevripvfttrpdtlfgatflvlapehpltlelaapekreevlayve aakrkteierqaegrektgvflgayalnpatgeripiwtadyvlfgygtgaimavpahdq rdyefarkfglpikkvierpgeplpeplerayeepgimvnsgpfdgteseegkrkviawl eekglgkgrvty
Timeline for d1obha2: