Lineage for d1obha2 (1obh A:226-417)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2802538Fold b.51: ValRS/IleRS/LeuRS editing domain [50676] (1 superfamily)
    core: barrel, closed; n=6, S=8; topology is similar to that of the acid proteases barrel
  4. 2802539Superfamily b.51.1: ValRS/IleRS/LeuRS editing domain [50677] (1 family) (S)
  5. 2802540Family b.51.1.1: ValRS/IleRS/LeuRS editing domain [50678] (4 proteins)
    inserted into the catalytic domain
  6. 2802556Protein Leucyl-tRNA synthetase (LeuRS) [82133] (1 species)
    in the prokaryotic and mitochondrial LeuRS this domain is inserted into a different sequential position
  7. 2802557Species Thermus thermophilus [TaxId:274] [82134] (3 PDB entries)
  8. 2802560Domain d1obha2: 1obh A:226-417 [86774]
    Other proteins in same PDB: d1obha1, d1obha3
    protein/RNA complex; complexed with hg, lms, nva, so4

Details for d1obha2

PDB Entry: 1obh (more details), 2.2 Å

PDB Description: leucyl-trna synthetase from thermus thermophilus complexed with a pre-transfer editing substrate analogue in both synthetic active site and editing site
PDB Compounds: (A:) leucyl-tRNA synthetase

SCOPe Domain Sequences for d1obha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1obha2 b.51.1.1 (A:226-417) Leucyl-tRNA synthetase (LeuRS) {Thermus thermophilus [TaxId: 274]}
rsegaeilfpvegkevripvfttrpdtlfgatflvlapehpltlelaapekreevlayve
aakrkteierqaegrektgvflgayalnpatgeripiwtadyvlfgygtgaimavpahdq
rdyefarkfglpikkvierpgeplpeplerayeepgimvnsgpfdgteseegkrkviawl
eekglgkgrvty

SCOPe Domain Coordinates for d1obha2:

Click to download the PDB-style file with coordinates for d1obha2.
(The format of our PDB-style files is described here.)

Timeline for d1obha2: