![]() | Class a: All alpha proteins [46456] (179 folds) |
![]() | Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.74.1: Cyclin-like [47954] (3 families) ![]() duplication: consists of two domains of this fold |
![]() | Family a.74.1.3: Retinoblastoma tumor suppressor domains [47969] (1 protein) |
![]() | Protein Retinoblastoma tumor suppressor domains [47970] (1 species) contains an additional C-terminal helix |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47971] (5 PDB entries) |
![]() | Domain d1o9kb_: 1o9k B: [86699] |
PDB Entry: 1o9k (more details), 2.6 Å
SCOP Domain Sequences for d1o9kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o9kb_ a.74.1.3 (B:) Retinoblastoma tumor suppressor domains {Human (Homo sapiens)} stslslfykkvyrlaylrlntlcerllsehpelehiiwtlfqhtlqneyelmrdrhldqi mmcsmygickvknidlkfkiivtaykdlphavqetfkrvlikeeeydsiivfynsvfmqr lktnilqyastrpptlspiphipr
Timeline for d1o9kb_: