Lineage for d1o9kd_ (1o9k D:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 283121Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 283122Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 283247Family a.74.1.3: Retinoblastoma tumor suppressor domains [47969] (1 protein)
  6. 283248Protein Retinoblastoma tumor suppressor domains [47970] (1 species)
    contains an additional C-terminal helix
  7. 283249Species Human (Homo sapiens) [TaxId:9606] [47971] (5 PDB entries)
  8. 283260Domain d1o9kd_: 1o9k D: [86701]

Details for d1o9kd_

PDB Entry: 1o9k (more details), 2.6 Å

PDB Description: crystal structure of the retinoblastoma tumour suppressor protein bound to e2f peptide

SCOP Domain Sequences for d1o9kd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o9kd_ a.74.1.3 (D:) Retinoblastoma tumor suppressor domains {Human (Homo sapiens)}
stslslfykkvyrlaylrlntlcerllsehpelehiiwtlfqhtlqneyelmrdrhldqi
mmcsmygickvknidlkfkiivtaykdlphavqetfkrvlikeeeydsiivfynsvfmqr
lktnilqyastrpptlspiphipr

SCOP Domain Coordinates for d1o9kd_:

Click to download the PDB-style file with coordinates for d1o9kd_.
(The format of our PDB-style files is described here.)

Timeline for d1o9kd_: