| Class g: Small proteins [56992] (90 folds) |
| Fold g.27: FnI-like domain [57602] (1 superfamily) disulfide-rich, all-beta |
Superfamily g.27.1: FnI-like domain [57603] (2 families) ![]() |
| Family g.27.1.1: Fibronectin type I module [57604] (2 proteins) automatically mapped to Pfam PF00039 |
| Protein Fibronectin [57605] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [57606] (13 PDB entries) |
| Domain d1o9aa1: 1o9a A:17-60 [86686] 1st and 2nd modules in complex with a peptide from the streptococcal fibronectin binding protein, FnbB, chain B |
PDB Entry: 1o9a (more details)
SCOPe Domain Sequences for d1o9aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o9aa1 g.27.1.1 (A:17-60) Fibronectin {Human (Homo sapiens) [TaxId: 9606]}
skpgcydngkhyqinqqwertylgnalvctcyggsrgfnceskp
Timeline for d1o9aa1: