Lineage for d1o80b_ (1o80 B:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 498854Fold d.9: IL8-like [54116] (1 superfamily)
    beta(3)-alpha
  4. 498855Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
    form dimers with different dimerisation modes
  5. 498856Family d.9.1.1: Interleukin 8-like chemokines [54118] (24 proteins)
  6. 498909Protein IP-10/CXCL10 [82573] (1 species)
  7. 498910Species Human (Homo sapiens) [TaxId:9606] [82574] (4 PDB entries)
  8. 498912Domain d1o80b_: 1o80 B: [86663]

Details for d1o80b_

PDB Entry: 1o80 (more details), 2 Å

PDB Description: crystal structure of ip-10 h-form

SCOP Domain Sequences for d1o80b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o80b_ d.9.1.1 (B:) IP-10/CXCL10 {Human (Homo sapiens)}
vplsrtvrctcisisnqpvnprslekleiipasqfcprveiiatmkkkgekrclnpeska
iknllkavskem

SCOP Domain Coordinates for d1o80b_:

Click to download the PDB-style file with coordinates for d1o80b_.
(The format of our PDB-style files is described here.)

Timeline for d1o80b_:

498912
d1o80b_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1o80a_