PDB entry 1o80

View 1o80 on RCSB PDB site
Description: crystal structure of ip-10 h-form
Deposited on 2002-11-20, released 2003-05-08
The last revision prior to the SCOP 1.69 freeze date was dated 2003-05-08, with a file datestamp of 2003-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.264
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1o80a_
  • Chain 'B':
    Domains in SCOP 1.69: d1o80b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1o80A (A:)
    vplsrtvrctcisisnqpvnprslekleiipasqfcprveiiatmkkkgekrclnpeska
    iknllkavskemskrsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o80A (A:)
    vplsrtvrctcisisnqpvnprslekleiipasqfcprveiiatmkkkgekrclnpeska
    iknllkavskemskr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1o80B (B:)
    vplsrtvrctcisisnqpvnprslekleiipasqfcprveiiatmkkkgekrclnpeska
    iknllkavskemskrsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1o80B (B:)
    vplsrtvrctcisisnqpvnprslekleiipasqfcprveiiatmkkkgekrclnpeska
    iknllkavskem