Lineage for d1o7ia_ (1o7i A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1541119Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1541191Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
    barrel, closed; n=5, S=10
  6. 1541192Protein Archaeal ssDNA-binding protein [89324] (1 species)
    similar to the domains of the Replication protein A
  7. 1541193Species Sulfolobus solfataricus [TaxId:2287] [89325] (1 PDB entry)
  8. 1541194Domain d1o7ia_: 1o7i A: [86642]
    complexed with so4

Details for d1o7ia_

PDB Entry: 1o7i (more details), 1.2 Å

PDB Description: crystal structure of a single stranded dna binding protein
PDB Compounds: (A:) single stranded DNA binding protein

SCOPe Domain Sequences for d1o7ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o7ia_ b.40.4.3 (A:) Archaeal ssDNA-binding protein {Sulfolobus solfataricus [TaxId: 2287]}
meekvgnlkpnmesvnvtvrvleasearqiqtkngvrtiseaivgdetgrvkltlwgkha
gsikegqvvkienawttafkgqvqlnagsktkiaeasedgfpessqipentptap

SCOPe Domain Coordinates for d1o7ia_:

Click to download the PDB-style file with coordinates for d1o7ia_.
(The format of our PDB-style files is described here.)

Timeline for d1o7ia_: