SCOPe 2.06: Domain d1o7d.1: 1o7d B:385-422,C:431-487

Lineage for d1o7d.1 (1o7d B:385-422,C:431-487)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.3: Families 57/38 glycoside transferase middle domain [88688] (4 families)

5. Family a.8.3.1: alpha-mannosidase, domain 2 [88693] (2 proteins)
   family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family

6. Protein Lysosomal alpha-mannosidase [89016] (1 species)
   the single-chain precursor is processed into 5 peptides; heavily glycosylated

7. Species Cow (Bos taurus) [TaxId:9913] [89017] (1 PDB entry)

8. Domain d1o7d.1: 1o7d B:385-422,C:431-487 [86639]
   Other proteins in same PDB: d1o7d.2, d1o7d.3
   complexed with nag, so4, trs, zn

Details for d1o7d.1

PDB Entry: 1o7d, 2.7 Å

PDB Description: the structure of the bovine lysosomal a-mannosidase suggests a novel mechanism for low ph activation

PDB Compounds: (B:) lysosomal alpha-mannosidase, (C:) lysosomal alpha-mannosidase

SCOPe Domain Sequences for d1o7d.1:

Sequence; same for both SEQRES and ATOM records:

>g1o7d.1 a.8.3.1 (B:385-422,C:431-487) Lysosomal alpha-mannosidase {Cow (Bos taurus) [TaxId: 9913]}
ymfwtgyfssrpalkryerlsynflqvcnqlealagpaXgdsaplneamavlqhhdavsg
tsrqhvandyarqlsegwrpcevlmsnalahlsglk

Timeline for d1o7d.1:

• d1o7d.1 first appeared in SCOP 1.65
  
• d1o7d.1 appears in SCOPe 2.05
  
• d1o7d.1 appears in SCOPe 2.07
  
• d1o7d.1 appears in the current release, SCOPe 2.08