| Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.17: Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain [51690] (1 family) ![]() incomplete beta/alpha barrel with parallel beta-sheet of 7 strands |
| Family c.1.17.1: Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain [51691] (1 protein) |
| Protein Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain [51692] (3 species) |
| Species Thermotoga maritima [TaxId:243274] [89507] (1 PDB entry) TM1645 |
| Domain d1o4ub1: 1o4u B:104-273 [86626] Other proteins in same PDB: d1o4ua2, d1o4ub2 structural genomics |
PDB Entry: 1o4u (more details), 2.5 Å
SCOP Domain Sequences for d1o4ub1:
Sequence, based on SEQRES records: (download)
>d1o4ub1 c.1.17.1 (B:104-273) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Thermotoga maritima}
vatttrrfaeklkhakiaatrkilpglgvlqkiavvhgggdphrldlsgcvmikdnhlkm
ygsaeravqevrkiipfttkievevenledalraveagadivmldnlspeevkdisrrik
dinpnvivevsggiteenvslydfetvdvisssrltlqevfvdlsleiqr
>d1o4ub1 c.1.17.1 (B:104-273) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Thermotoga maritima}
vatttrrfaeklkhakiaatrkilpglgvlqkiavvhgggdgcvmikdnhlkmygsaera
vqevrkiipfttkievevenledalraveagadivmldnlspeevkdisrrikdinpnvi
vevsggiteenvslydfetvdvisssrltlqevfvdlsleiqr
Timeline for d1o4ub1: