Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) contains a small beta-sheet (wing) |
Family a.4.5.4: CAP C-terminal domain-like [46796] (8 proteins) |
Protein Catabolite gene activator protein (CAP), C-terminal domain [46797] (1 species) N-terminal domain has double beta-helix fold |
Species Escherichia coli [TaxId:562] [46798] (19 PDB entries) |
Domain d1o3qa1: 1o3q A:138-207 [86605] Other proteins in same PDB: d1o3qa2 complexed with cmp |
PDB Entry: 1o3q (more details), 3 Å
SCOP Domain Sequences for d1o3qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o3qa1 a.4.5.4 (A:138-207) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]} dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis ahgktivvyg
Timeline for d1o3qa1: