SCOP 1.73: Domain d1o3qa1: 1o3q A:138-207

Lineage for d1o3qa1 (1o3q A:138-207)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.4: CAP C-terminal domain-like [46796] (6 proteins)

6. Protein Catabolite gene activator protein (CAP), C-terminal domain [46797] (1 species)
   N-terminal domain has double beta-helix fold

7. Species Escherichia coli [TaxId:562] [46798] (19 PDB entries)

8. Domain d1o3qa1: 1o3q A:138-207 [86605]
   Other proteins in same PDB: d1o3qa2
   complexed with cmp

Details for d1o3qa1

PDB Entry: 1o3q, 3 Å

PDB Description: protein-dna recognition and dna deformation revealed in crystal structures of cap-dna complexes

PDB Compounds: (A:) catabolite gene activator protein

SCOP Domain Sequences for d1o3qa1:

Sequence; same for both SEQRES and ATOM records:

>d1o3qa1 a.4.5.4 (A:138-207) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]}
dvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis
ahgktivvyg

Timeline for d1o3qa1:

• d1o3qa1 first appeared in SCOP 1.65
  
• d1o3qa1 appears in SCOP 1.71
  
• d1o3qa1 appears in SCOP 1.75
  
• d1o3qa1 appears in the current release, SCOPe 2.08