Lineage for d1o2fb_ (1o2f B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1662475Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
    alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243
  4. 1662476Superfamily d.95.1: Glucose permease domain IIB [55604] (1 family) (S)
  5. 1662477Family d.95.1.1: Glucose permease domain IIB [55605] (1 protein)
  6. 1662478Protein Glucose permease domain IIB [55606] (1 species)
  7. 1662479Species Escherichia coli [TaxId:562] [55607] (4 PDB entries)
    there are differences in secondary structure packing between the two NMR-determined structures
  8. 1662484Domain d1o2fb_: 1o2f B: [86594]
    Other proteins in same PDB: d1o2fa_

Details for d1o2fb_

PDB Entry: 1o2f (more details)

PDB Description: complex of enzyme iiaglc and iibglc phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure
PDB Compounds: (B:) PTS system, glucose-specific IIBC component

SCOPe Domain Sequences for d1o2fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o2fb_ d.95.1.1 (B:) Glucose permease domain IIB {Escherichia coli [TaxId: 562]}
emaaalvaafggkenitnldacitrlrvsvadvskvdqaglkklgaagvvvagsgvqaif
gtksdnlktemdeyirn

SCOPe Domain Coordinates for d1o2fb_:

Click to download the PDB-style file with coordinates for d1o2fb_.
(The format of our PDB-style files is described here.)

Timeline for d1o2fb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1o2fa_