Lineage for d1o29b_ (1o29 B:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 615922Fold d.207: Thymidylate synthase-complementing protein Thy1 [69795] (1 superfamily)
    complex alpha+beta fold; contains antiparallel 5-stranded beta-sheet: order 12354
  4. 615923Superfamily d.207.1: Thymidylate synthase-complementing protein Thy1 [69796] (1 family) (S)
  5. 615924Family d.207.1.1: Thymidylate synthase-complementing protein Thy1 [69797] (1 protein)
  6. 615925Protein Thy1 homologue [69798] (1 species)
  7. 615926Species Thermotoga maritima [TaxId:243274] [69799] (9 PDB entries)
    TM0449
  8. 615936Domain d1o29b_: 1o29 B: [86579]

Details for d1o29b_

PDB Entry: 1o29 (more details), 2 Å

PDB Description: crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima with fad and fdump at 2.0 a resolution

SCOP Domain Sequences for d1o29b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o29b_ d.207.1.1 (B:) Thy1 homologue {Thermotoga maritima}
mkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieylmkhghetpfehi
vftfhvkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttippervte
kiseivdkayrtyleliesgvprevarivlplnlytrffwtvnarslmnflnlradshaq
weiqqyalaiarifkekcpwtfeaflkyaykgdilkevqv

SCOP Domain Coordinates for d1o29b_:

Click to download the PDB-style file with coordinates for d1o29b_.
(The format of our PDB-style files is described here.)

Timeline for d1o29b_: