SCOPe 2.08: Domain d1o29b_: 1o29 B:

Lineage for d1o29b_ (1o29 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.207: Thymidylate synthase-complementing protein Thy1 [69795] (1 superfamily)
   complex alpha+beta fold; contains antiparallel 5-stranded beta-sheet: order 12354

4. Superfamily d.207.1: Thymidylate synthase-complementing protein Thy1 [69796] (2 families)
   automatically mapped to Pfam PF02511

5. Family d.207.1.1: Thymidylate synthase-complementing protein Thy1 [69797] (2 proteins)

6. Protein Thy1 homologue [69798] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [69799] (29 PDB entries)
   TM0449

8. Domain d1o29b_: 1o29 B: [86579]
   Other proteins in same PDB: d1o29a2
   structural genomics
   complexed with fad, ufp

Details for d1o29b_

PDB Entry: 1o29, 2 Å

PDB Description: crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima with fad and fdump at 2.0 a resolution

PDB Compounds: (B:) Thymidylate synthase thyX

SCOPe Domain Sequences for d1o29b_:

Sequence; same for both SEQRES and ATOM records:

>d1o29b_ d.207.1.1 (B:) Thy1 homologue {Thermotoga maritima [TaxId: 2336]}
mkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieylmkhghetpfehi
vftfhvkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttippervte
kiseivdkayrtyleliesgvprevarivlplnlytrffwtvnarslmnflnlradshaq
weiqqyalaiarifkekcpwtfeaflkyaykgdilkevqv

Timeline for d1o29b_:

• d1o29b_ first appeared in SCOP 1.65
  
• d1o29b_ appears in SCOPe 2.07