SCOPe 2.02: Domain d1o29a_: 1o29 A:

Lineage for d1o29a_ (1o29 A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.207: Thymidylate synthase-complementing protein Thy1 [69795] (1 superfamily)
   complex alpha+beta fold; contains antiparallel 5-stranded beta-sheet: order 12354

4. Superfamily d.207.1: Thymidylate synthase-complementing protein Thy1 [69796] (1 family)

5. Family d.207.1.1: Thymidylate synthase-complementing protein Thy1 [69797] (2 proteins)

6. Protein Thy1 homologue [69798] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [69799] (9 PDB entries)
   TM0449

8. Domain d1o29a_: 1o29 A: [86578]
   structural genomics
   complexed with fad, ufp

Details for d1o29a_

PDB Entry: 1o29, 2 Å

PDB Description: crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima with fad and fdump at 2.0 a resolution

PDB Compounds: (A:) Thymidylate synthase thyX

SCOPe Domain Sequences for d1o29a_:

Sequence; same for both SEQRES and ATOM records:

>d1o29a_ d.207.1.1 (A:) Thy1 homologue {Thermotoga maritima [TaxId: 2336]}
hmkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieylmkhghetpfeh
ivftfhvkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttippervt
ekiseivdkayrtyleliesgvprevarivlplnlytrffwtvnarslmnflnlradsha
qweiqqyalaiarifkekcpwtfeaflkyaykgdil

Timeline for d1o29a_:

• d1o29a_ first appeared in SCOP 1.65
  
• d1o29a_ appears in SCOPe 2.01
  
• d1o29a_ appears in SCOPe 2.03
  
• d1o29a_ appears in the current release, SCOPe 2.08, called d1o29a1