SCOPe 2.04: Domain d1o28a_: 1o28 A:

Lineage for d1o28a_ (1o28 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.207: Thymidylate synthase-complementing protein Thy1 [69795] (1 superfamily)
   complex alpha+beta fold; contains antiparallel 5-stranded beta-sheet: order 12354

4. Superfamily d.207.1: Thymidylate synthase-complementing protein Thy1 [69796] (1 family)
   automatically mapped to Pfam PF02511

5. Family d.207.1.1: Thymidylate synthase-complementing protein Thy1 [69797] (2 proteins)

6. Protein Thy1 homologue [69798] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [69799] (22 PDB entries)
   TM0449

8. Domain d1o28a_: 1o28 A: [86574]
   structural genomics
   complexed with epe, pge, ufp

Details for d1o28a_

PDB Entry: 1o28, 2.1 Å

PDB Description: crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima with fdump at 2.1 a resolution

PDB Compounds: (A:) Thymidylate synthase thyX

SCOPe Domain Sequences for d1o28a_:

Sequence; same for both SEQRES and ATOM records:

>d1o28a_ d.207.1.1 (A:) Thy1 homologue {Thermotoga maritima [TaxId: 2336]}
hhhmkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieylmkhghetpf
ehivftfhvkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttipper
vtekiseivdkayrtyleliesgvprevarivlplnlytrffwtvnarslmnflnlrads
haqweiqqyalaiarifkekcpwtfeaflkyaykgdil

Timeline for d1o28a_:

• d1o28a_ first appeared in SCOP 1.65
  
• d1o28a_ appears in SCOPe 2.03
  
• d1o28a_ appears in SCOPe 2.05
  
• d1o28a_ appears in the current release, SCOPe 2.08, called d1o28a1