SCOPe 2.07: Domain d1o0ba2: 1o0b A:8-338

Lineage for d1o0ba2 (1o0b A:8-338)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
   contains a conserved all-alpha subdomain at the C-terminal extension

6. Protein Glutaminyl-tRNA synthetase (GlnRS) [52380] (2 species)

7. Species Escherichia coli [TaxId:562] [52381] (17 PDB entries)

8. Domain d1o0ba2: 1o0b A:8-338 [86528]
   Other proteins in same PDB: d1o0ba1
   protein/RNA complex; complexed with amp, gln, so4

Details for d1o0ba2

PDB Entry: 1o0b, 2.7 Å

PDB Description: crystal structure of l-glutamine and ampcpp bound to glutamine aminoacyl trna synthetase

PDB Compounds: (A:) glutaminyl-tRNA synthetase

SCOPe Domain Sequences for d1o0ba2:

Sequence; same for both SEQRES and ATOM records:

>d1o0ba2 c.26.1.1 (A:8-338) Glutaminyl-tRNA synthetase (GlnRS) {Escherichia coli [TaxId: 562]}
tnfirqiidedlasgkhttvhtrfppepngylhighaksiclnfgiaqdykgqcnlrfdd
tnpvkedieyvesikndvewlgfhwsgnvryssdyfdqlhayaielinkglayvdeltpe
qireyrgtltqpgknspyrdrsveenlalfekmraggfeegkaclrakidmaspfivmrd
pvlyrikfaehhqtgnkwciypmydfthcisdalegithslctlefqdnrrlydwvldni
tipvhprqyefsrlnleytvmskrklnllvtdkhvegwddprmptisglrrrgytaasir
efckrigvtkqdntiemaslesciredlnen

Timeline for d1o0ba2:

• d1o0ba2 first appeared in SCOP 1.65
  
• d1o0ba2 appears in SCOPe 2.06
  
• d1o0ba2 appears in the current release, SCOPe 2.08