Lineage for d1nz6a_ (1nz6 A:)
- Root: SCOP 1.67
Class a: All alpha proteins [46456] (202 folds) 
Fold a.2: Long alpha-hairpin [46556] (12 superfamilies)
2 helices; antiparallel hairpin, left-handed twist
Superfamily a.2.3: Chaperone J-domain [46565] (1 family) 
Family a.2.3.1: Chaperone J-domain [46566] (6 proteins) 
Protein Auxilin J-domain [88969] (1 species) Species Cow (Bos taurus) [TaxId:9913] [88970] (2 PDB entries) 
Domain d1nz6a_: 1nz6 A: [86441]
Details for d1nz6a_
PDB Entry: 1nz6 (more details), 2.5 Å
PDB Description: Crystal Structure of Auxilin J-Domain
SCOP Domain Sequences for d1nz6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus)}
dpeklkilewiegkernirallstmhtvlwagetkwkpvgmadlvtpeqvkkvyrkavlv
vhpdkatgqpyeqyakmifmelndawsefenqgqkply
SCOP Domain Coordinates for d1nz6a_:
Click to download the PDB-style file with coordinates for d1nz6a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nz6a_:
- d1nz6a_ first appeared in SCOP 1.65
- d1nz6a_ appears in SCOP 1.69
- d1nz6a_ appears in the current release, SCOPe 2.08
View in 3D
