SCOP 1.67: Domain d1nytb2: 1nyt B:1-101

Lineage for d1nytb2 (1nyt B:1-101)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families)

5. Family c.58.1.5: Shikimate dehydrogenase-like [82336] (3 proteins)

6. Protein Shikimate 5-dehydrogenase AroE [89584] (3 species)

7. Species Escherichia coli [TaxId:562] [89585] (1 PDB entry)

8. Domain d1nytb2: 1nyt B:1-101 [86420]
   Other proteins in same PDB: d1nyta1, d1nytb1, d1nytc1, d1nytd1

Details for d1nytb2

PDB Entry: 1nyt, 1.5 Å

PDB Description: shikimate dehydrogenase aroe complexed with nadp+

SCOP Domain Sequences for d1nytb2:

Sequence; same for both SEQRES and ATOM records:

>d1nytb2 c.58.1.5 (B:1-101) Shikimate 5-dehydrogenase AroE {Escherichia coli}
metyavfgnpiahskspfihqqfaqqlniehpygrvlapindfintlnaffsaggkganv
tvpfkeeafaradelteraalagavntlmrledgrllgdnt

Timeline for d1nytb2:

• d1nytb2 first appeared in SCOP 1.65
  
• d1nytb2 appears in SCOP 1.69
  
• d1nytb2 appears in the current release, SCOPe 2.08