Lineage for d1nytb2 (1nyt B:1-101)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 317634Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 317635Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) (S)
  5. 317832Family c.58.1.5: Shikimate dehydrogenase-like [82336] (3 proteins)
  6. 317839Protein Shikimate 5-dehydrogenase AroE [89584] (2 species)
  7. 317843Species Escherichia coli [TaxId:562] [89585] (1 PDB entry)
  8. 317845Domain d1nytb2: 1nyt B:1-101 [86420]
    Other proteins in same PDB: d1nyta1, d1nytb1, d1nytc1, d1nytd1

Details for d1nytb2

PDB Entry: 1nyt (more details), 1.5 Å

PDB Description: shikimate dehydrogenase aroe complexed with nadp+

SCOP Domain Sequences for d1nytb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nytb2 c.58.1.5 (B:1-101) Shikimate 5-dehydrogenase AroE {Escherichia coli}
metyavfgnpiahskspfihqqfaqqlniehpygrvlapindfintlnaffsaggkganv
tvpfkeeafaradelteraalagavntlmrledgrllgdnt

SCOP Domain Coordinates for d1nytb2:

Click to download the PDB-style file with coordinates for d1nytb2.
(The format of our PDB-style files is described here.)

Timeline for d1nytb2: