Class a: All alpha proteins [46456] (179 folds) |
Fold a.181: Antibiotic binding domain of TipA-like multidrug resistance regulators [89081] (1 superfamily) 5 helices: orthogonal array |
Superfamily a.181.1: Antibiotic binding domain of TipA-like multidrug resistance regulators [89082] (1 family) |
Family a.181.1.1: Antibiotic binding domain of TipA-like multidrug resistance regulators [89083] (1 protein) |
Protein Transcriptional activator TipA-S [89084] (1 species) |
Species Streptomyces lividans [TaxId:1916] [89085] (1 PDB entry) |
Domain d1ny9a_: 1ny9 A: [86401] |
PDB Entry: 1ny9 (more details)
SCOP Domain Sequences for d1ny9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ny9a_ a.181.1.1 (A:) Transcriptional activator TipA-S {Streptomyces lividans} wqriqdeadeltrrfvalmdagepadsegamdaaedhrqgiarnhydcgyemhtclgemy vsderftrnidaakpglaaymrdailanavrhtp
Timeline for d1ny9a_: