Lineage for d1ny9a_ (1ny9 A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 287063Fold a.181: Antibiotic binding domain of TipA-like multidrug resistance regulators [89081] (1 superfamily)
    5 helices: orthogonal array
  4. 287064Superfamily a.181.1: Antibiotic binding domain of TipA-like multidrug resistance regulators [89082] (1 family) (S)
  5. 287065Family a.181.1.1: Antibiotic binding domain of TipA-like multidrug resistance regulators [89083] (1 protein)
  6. 287066Protein Transcriptional activator TipA-S [89084] (1 species)
  7. 287067Species Streptomyces lividans [TaxId:1916] [89085] (1 PDB entry)
  8. 287068Domain d1ny9a_: 1ny9 A: [86401]

Details for d1ny9a_

PDB Entry: 1ny9 (more details)

PDB Description: antibiotic binding domain of a tipa-class multidrug resistance transcriptional regulator

SCOP Domain Sequences for d1ny9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ny9a_ a.181.1.1 (A:) Transcriptional activator TipA-S {Streptomyces lividans}
wqriqdeadeltrrfvalmdagepadsegamdaaedhrqgiarnhydcgyemhtclgemy
vsderftrnidaakpglaaymrdailanavrhtp

SCOP Domain Coordinates for d1ny9a_:

Click to download the PDB-style file with coordinates for d1ny9a_.
(The format of our PDB-style files is described here.)

Timeline for d1ny9a_: