Lineage for d1ny9a_ (1ny9 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014324Fold a.181: Antibiotic binding domain of TipA-like multidrug resistance regulators [89081] (1 superfamily)
    5 helices: orthogonal array
  4. 2014325Superfamily a.181.1: Antibiotic binding domain of TipA-like multidrug resistance regulators [89082] (1 family) (S)
    automatically mapped to Pfam PF07739
  5. 2014326Family a.181.1.1: Antibiotic binding domain of TipA-like multidrug resistance regulators [89083] (1 protein)
  6. 2014327Protein Transcriptional activator TipA-S [89084] (1 species)
  7. 2014328Species Streptomyces lividans [TaxId:1916] [89085] (1 PDB entry)
  8. 2014329Domain d1ny9a_: 1ny9 A: [86401]

Details for d1ny9a_

PDB Entry: 1ny9 (more details)

PDB Description: Antibiotic binding domain of a TipA-class multidrug resistance transcriptional regulator
PDB Compounds: (A:) Transcriptional activator tipA-S

SCOPe Domain Sequences for d1ny9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ny9a_ a.181.1.1 (A:) Transcriptional activator TipA-S {Streptomyces lividans [TaxId: 1916]}
wqriqdeadeltrrfvalmdagepadsegamdaaedhrqgiarnhydcgyemhtclgemy
vsderftrnidaakpglaaymrdailanavrhtp

SCOPe Domain Coordinates for d1ny9a_:

Click to download the PDB-style file with coordinates for d1ny9a_.
(The format of our PDB-style files is described here.)

Timeline for d1ny9a_: