SCOPe 2.07: Domain d1ny722: 1ny7 2:183-369

Lineage for d1ny722 (1ny7 2:183-369)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.2: Comoviridae-like VP [88636] (3 proteins)
   duplication: mature coat protein consists of three similar domains that can be in a single chain or in two separate chains

6. Protein Comovirus coat proteins (VP37 and VP23) [49627] (2 species)
   chain 1 is one-domain VP23; chain 2 is two-domain VP37

7. Species CPMV (Cowpea mosaic virus) [TaxId:12264] [89227] (2 PDB entries)

8. Domain d1ny722: 1ny7 2:183-369 [86400]

Details for d1ny722

PDB Entry: 1ny7, 3 Å

PDB Description: cowpea mosaic virus (cpmv)

PDB Compounds: (2:) cowpea mosaic virus, large (l) subunit

SCOPe Domain Sequences for d1ny722:

Sequence; same for both SEQRES and ATOM records:

>d1ny722 b.121.4.2 (2:183-369) Comovirus coat proteins (VP37 and VP23) {CPMV (Cowpea mosaic virus) [TaxId: 12264]}
hladcqnwlplnrwmgkltfpqgvtsevrrmplsigggagatqaflanmpnswismwryf
rgelhfevtkmsspyikatvtfliafgnlsdafgfyesfphrivqfaeveekctlvfsqq
efvtawstqvnprttleadgcpylyaiihdsttgtisgdfnlgvklvgikdfcgigsnpg
idgsrll

Timeline for d1ny722:

• d1ny722 first appeared in SCOP 1.65
  
• d1ny722 appears in SCOPe 2.06
  
• d1ny722 appears in the current release, SCOPe 2.08