Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies) variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands |
Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) in the different families beta-barrels are similarly distorted but may vary in the number of strands |
Family c.6.2.3: NodB-like polysaccharide deacetylase [89559] (7 proteins) variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=6, S=8; strand order 123456 |
Protein Probable polysaccharide deacetylase PdaA [89560] (1 species) |
Species Bacillus subtilis [TaxId:1423] [89561] (2 PDB entries) |
Domain d1ny1a_: 1ny1 A: [86395] structural genomics; target SR127 |
PDB Entry: 1ny1 (more details), 1.8 Å
SCOPe Domain Sequences for d1ny1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ny1a_ c.6.2.3 (A:) Probable polysaccharide deacetylase PdaA {Bacillus subtilis [TaxId: 1423]} vpnepinwgfkrsvnhqppdagkqlnsliekydafylgntkektiyltfdngyengytpk vldvlkkhrvtgtffvtghfvkdqpqlikrmsdeghiignhsfhhpdlttktadqiqdel dsvneevykitgkqdnlylrpprgvfseyvlketkrlgyqtvfwsvafvdwkinnqkgkk yaydhmikqahpgaiyllhtvsrdnaealddaitdlkkqgytfksiddlmfekem
Timeline for d1ny1a_: