SCOPe 2.05: Domain d1nxgb_: 1nxg B:

Lineage for d1nxgb_ (1nxg B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.103: Citrate synthase [48255] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.103.1: Citrate synthase [48256] (2 families)

5. Family a.103.1.1: Citrate synthase [48257] (2 proteins)
   duplication: large domain consists of two structural repeats
   the second repeat is interrupted by the small domain
   automatically mapped to Pfam PF00285

6. Protein Citrate synthase [48258] (7 species)

7. Species Escherichia coli [TaxId:562] [81862] (9 PDB entries)
   Uniprot P00891

8. Domain d1nxgb_: 1nxg B: [86380]
   complexed with nai, so4

Details for d1nxgb_

PDB Entry: 1nxg, 2.5 Å

PDB Description: the f383a variant of type ii citrate synthase complexed with nadh

PDB Compounds: (B:) citrate synthase

SCOPe Domain Sequences for d1nxgb_:

Sequence; same for both SEQRES and ATOM records:

>d1nxgb_ a.103.1.1 (B:) Citrate synthase {Escherichia coli [TaxId: 562]}
adtkakltlngdtaveldvlkgtlgqdvidirtlgskgvftfdpgftstasceskitfid
gdegillhrgfpidqlatdsnylevcyillngekptqeqydefkttvtrhtmiheqitrl
fhafrrdshpmavmcgitgalaafyhdsldvnnprhreiaafrllskmptmaamcykysi
gqpfvyprndlsyagnflnmmfstpcepyevnpileramdrililhadheqnaststvrt
agssganpfaciaagiaslwgpahgganeaalkmleeissvkhipeffrrakdkndsfrl
mgfghrvyknydpratvmretchevlkelgtkddllevamelenialndpyfiekklypn
vdfysgiilkamgipssmftviaamartvgwiahwsemhsdgmkiarprqlytgyekrdf
ksdikr

Timeline for d1nxgb_:

• d1nxgb_ first appeared in SCOP 1.65
  
• d1nxgb_ appears in SCOPe 2.04
  
• d1nxgb_ appears in SCOPe 2.06
  
• d1nxgb_ appears in the current release, SCOPe 2.08