Lineage for d1nwy1_ (1nwy 1:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3043573Family i.1.1.2: Large subunit [58124] (3 proteins)
  6. 3043708Protein Prokaryotic (50S subunit) [58125] (3 species)
  7. 3043709Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries)
  8. 3043778Domain d1nwy1_: 1nwy 1: [86340]
    CA-atoms only for the ribosomal protein structures
    complexed with zit

Details for d1nwy1_

PDB Entry: 1nwy (more details), 3.3 Å

PDB Description: complex of the large ribosomal subunit from deinococcus radiodurans with azithromycin
PDB Compounds: (1:) ribosomal protein L33

SCOPe Domain Sequences for d1nwy1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nwy1_ i.1.1.2 (1:) Prokaryotic (50S subunit) {Deinococcus radiodurans [TaxId: 1299]}
akdgpriivkmessagtgfyytttknrrntqaklelkkydpvakkhvvfrekk

SCOPe Domain Coordinates for d1nwy1_:

Click to download the PDB-style file with coordinates for d1nwy1_.
(The format of our PDB-style files is described here.)

Timeline for d1nwy1_: