PDB entry 1nwy

View 1nwy on RCSB PDB site
Description: complex of the large ribosomal subunit from deinococcus radiodurans with azithromycin
Class: ribosome
Keywords: azithromycin, macrolide, ketolide, ribosome, 50s, ribosomal
Deposited on 2003-02-07, released 2003-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.279
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: 23s ribosomal rRNA
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene:
  • Chain '1':
    Compound: ribosomal protein L33
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nwy1_
  • Chain '2':
    Compound: ribosomal protein L34
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nwy2_
  • Chain '3':
    Compound: ribosomal protein L35
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nwy3_
  • Chain '4':
    Compound: ribosomal protein L36
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nwy4_
  • Chain '9':
    Compound: 5s ribosomal rRNA
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene:
  • Chain 'A':
    Compound: ribosomal protein l2
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nwya_
  • Chain 'B':
    Compound: ribosomal protein l3
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nwyb_
  • Chain 'C':
    Compound: ribosomal protein l4
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nwyc_
  • Chain 'D':
    Compound: ribosomal protein l5
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nwyd_
  • Chain 'E':
    Compound: ribosomal protein l6
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nwye_
  • Chain 'F':
    Compound: ribosomal protein l9
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nwyf_
  • Chain 'G':
    Compound: ribosomal protein l11
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nwyg_
  • Chain 'H':
    Compound: ribosomal protein l13
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nwyh_
  • Chain 'I':
    Compound: ribosomal protein l14
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nwyi_
  • Chain 'J':
    Compound: ribosomal protein l15
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nwyj_
  • Chain 'K':
    Compound: ribosomal protein L16
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nwyk_
  • Chain 'L':
    Compound: ribosomal protein L17
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nwyl_
  • Chain 'M':
    Compound: ribosomal protein l18
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nwym_
  • Chain 'N':
    Compound: ribosomal protein l19
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nwyn_
  • Chain 'O':
    Compound: ribosomal protein L20
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nwyo_
  • Chain 'P':
    Compound: ribosomal protein L21
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nwyp_
  • Chain 'Q':
    Compound: ribosomal protein l22
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nwyq_
  • Chain 'R':
    Compound: ribosomal protein l23
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nwyr_
  • Chain 'S':
    Compound: ribosomal protein l24
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nwys_
  • Chain 'T':
    Compound: general stress protein ctc
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nwyt_
  • Chain 'U':
    Compound: ribosomal protein L27
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nwyu_
  • Chain 'W':
    Compound: ribosomal protein l29
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nwyw_
  • Chain 'X':
    Compound: ribosomal protein l30
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nwyx_
  • Chain 'Y':
    Compound: ribosomal protein L31
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nwyy_
  • Chain 'Z':
    Compound: ribosomal protein l32
    Species: Deinococcus radiodurans [TaxId:1299]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nwyz_
  • Heterogens: ZIT

PDB Chain Sequences:

  • Chain '0':
    No sequence available.

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >1nwy1 (1:)
    makdgpriivkmessagtgfyytttknrrntqaklelkkydpvakkhvvfrekkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nwy1 (1:)
    akdgpriivkmessagtgfyytttknrrntqaklelkkydpvakkhvvfrekk
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >1nwy2 (2:)
    mkrtyqpnnrkrakthgfrarmktksgrnilarrrakgrhqltvsde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nwy2 (2:)
    mkrtyqpnnrkrakthgfrarmktksgrnilarrrakgrhqltvsd
    

  • Chain '3':
    Sequence, based on SEQRES records: (download)
    >1nwy3 (3:)
    pkmkthkmakrrikitgtgkvmafksgkrhqntgksgdeirgkgkgfvlakaewarmklm
    lprgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nwy3 (3:)
    pkmkthkmakrrikitgtgkvmafksgkrhqntgksgdeirgkgkgfvlakaewarmklm
    lpr
    

  • Chain '4':
    Sequence, based on SEQRES records: (download)
    >1nwy4 (4:)
    mkvrssvkkmcdnckvvrrhgrvlvicsnvkhkqrqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nwy4 (4:)
    kvrssvkkmcdnckvvrrhgrvlvicsnvkhkqrq
    

  • Chain '9':
    No sequence available.

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nwyA (A:)
    avkkyrpytpsrrqmttadfsgltkkrpekaltealpktggrnnrgritsrfiggghkrl
    yriidfkrrdksgvnakvaaieydpnrsariallhyadgekryilapegltvgatvnagp
    eaepklgnalplrfvpvgavvhalelvpgkgaqlarsagtsvqvqgkesdyvivrlpsge
    lrrvhsecyatigavgnaehknivlgkagrsrwlgrkphqrgsamnpvdhphgggegrtg
    agrvpvtpwgkptkglktrrkrktsdrfivtrrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nwyA (A:)
    kkyrpytpsrrqmttadfsgltkkrpekaltealpktggrnnrgritsrfiggghkrlyr
    iidfkrrdksgvnakvaaieydpnrsariallhyadgekryilapegltvgatvnagpea
    epklgnalplrfvpvgavvhalelvpgkgaqlarsagtsvqvqgkesdyvivrlpsgelr
    rvhsecyatigavgnaehknivlgkagrsrwlgrkphqrgsamnpvdhphgggegrtgag
    rvpvtpwgkptkglktrrkrktsdrfivtr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nwyB (B:)
    mkgilgtkigmtqiwkndraipvtvvlagpcpivqrktaqtdgyeavqigyapkaerkvn
    kpmqghfakagvaptrilrefrgfapdgdsvnvdifaegekidatgtskgkgtqgvmkrw
    nfaggpashgskkwhrrpgsigqrktpgrvykgkrmaghmgmervtvqnlevveiragen
    lilvkgaipgangglvvlrsaakasaakggk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nwyB (B:)
    mkgilgtkigmtqiwkndraipvtvvlagpcpivqrktaqtdgyeavqigyapkaerkvn
    kpmqghfakagvaptrilrefrgfapdgdsvnvdifaegekidatgtskgkgtqgvmkrw
    nfaggpashgskkwhrrpgsigqrktpgrvykgkrmaghmgmervtvqnlevveiragen
    lilvkgaipgangglvvlrsaakas
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1nwyC (C:)
    aqinvigqnggrtielplpevnsgvlhevvtwqlasrrrgtastrtraqvsktgrkmygq
    kgtgnarhgdrsvptfvgggvafgpkprsydytlprqvrqlglamaiasrqeggklvavd
    gfdiadaktknfiswakqngldgtekvllvtddentrraarnvswvsvlpvagvnvydil
    rhdrlvidaaaleiveeeageeqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nwyC (C:)
    aqinvigqnggrtielplpevnsgvlhevvtwqlasrrrgtastrtraqvsktgrkmygq
    kgtgnarhgdrsvptfvgggvafgpkprsydytlprqvrqlglamaiasrqeggklvavd
    gfdiadaktknfiswakqngldgtekvllvtddentrraarnvswvsvlpvagvnvydil
    rhdrlvidaaaleivee
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nwyD (D:)
    mqqlktkyndqvrpalmqqfgyssvmavpriekivvneglgsskedskaidkaakelali
    tlqkpiitkakksisnfklrqgmpvgikvtlrgermyvflekliniglprirdfrginpn
    afdgrgnynlgikeqlifpeitydmvdktrgmditivttaktdeearallqsmglpfrkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nwyD (D:)
    qqlktkyndqvrpalmqqfgyssvmavpriekivvneglgsskedskaidkaakelalit
    lqkpiitkakksisnfklrqgmpvgikvtlrgermyvflekliniglprirdfrginpna
    fdgrgnynlgikeqlifpeitydmvdktrgmditivttaktdeearallqsmglpfrk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1nwyE (E:)
    msrigkqpiavpsgvtvnaqdgvfkvkgpkgeltvpynteltvrqdgdqllverpsdaqk
    hralhgltrtlvanavkgvsdgytinlelrgvgfrakltgkalemnigyshpviieppag
    vtfavpeptridvsgidkqlvgqvaanvrkvrkpdayhgkgvrfvgeqialkagkagatg
    gkgkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nwyE (E:)
    gkqpiavpsgvtvnaqdgvfkvkgpkgeltvpynteltvrqdgdqllverpsdaqkhral
    hgltrtlvanavkgvsdgytinlelrgvgfrakltgkalemnigyshpviieppagvtfa
    vpeptridvsgidkqlvgqvaanvrkvrkpdayhgkgvrfvgeqialkagkagatgg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1nwyF (F:)
    mqvillepsrlgktgevvsvkdgyarnwlipqglavsatrtnmktleaqlrsiekrqaqe
    kavaedlasrlngvavelsvragegkiygavthqdvansldqlgfdvdrrkidmpktvke
    vgeydiayrahpevtipmklvvhaak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nwyF (F:)
    mqvillepsrlgktgevvsvkdgyarnwlipqglavsatrtnmktleaqlrs
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1nwyG (G:)
    mkkvagivklqlpagkatpappvgpalgqyganimeftkafnaqtadkgdaiipveitiy
    adrsftfitktppmsylirkaagigkgsstpnkakvgklnwdqvleiaktkmpdlnagsv
    eaaantvagtarsmgvtveggpna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nwyG (G:)
    mkkvagivklqlpagkatpappvgpalgqyganimeftkafnaqtadkgdaiipveitiy
    adrsftfitktppmsylirkaagigkgsstpnkakvgklnwdqvleiaktkmpdlnagsv
    eaaantvagtarsmgvtveggpn
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1nwyH (H:)
    mafpdtdvspprggpsspakspllrsfkvktyipkndeqnwvvvdasgvplgrlatlias
    rirgkhrpdftpnmiqgdfvvvinaaqvaltgkklddkvytrytgyqgglktetareals
    khperviehavfgmlpkgrqgramhtrlkvyagethphsaqkpqvlktqplevk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nwyH (H:)
    vktyipkndeqnwvvvdasgvplgrlatliasrirgkhrpdftpnmiqgdfvvvinaaqv
    altgkklddkvytrytgyqgglktetarealskhperviehavfgmlpkgrqgramhtrl
    kvyagethphsaqkpqvlktqpl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1nwyI (I:)
    mimpqsrldvadnsgareimcirvlnsgiggkglttggggnkryahvgdiivasvkdaap
    rgavkagdvvkavvvrtshaikradgstirfdrnaaviinnqgeprgtrvfgpvarelrd
    rrfmkivslapevl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nwyI (I:)
    impqsrldvadnsgareimcirvlnsgiggkglttggggnkryahvgdiivasvkdaapr
    gavkagdvvkavvvrtshaikradgstirfdrnaaviinnqgeprgtrvfgpvarelrdr
    rfmkivslapev
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1nwyJ (J:)
    mklhdlkptpgsrkdrkrvgrgpggtdktagrghkgqksrsgagkgaffeggrsrliarl
    pkrgfnnvgttyevvklsqlqdledttfdrdtleayrlvrrknrpvkllasgeisravtv
    hvdaasaaaikaveaaggrvvlpevqtqqddaqkae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nwyJ (J:)
    hdlkptpgsrkdrkrvgrgpggtdktagrghkgqksrsgagkgaffeggrsrliarlpkr
    gfnnvgttyevvklsqlqdledttfdrdtleayrlvrrknrpvkllasgeisravtvhvd
    aasaaaikaveaaggrvvlpe
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1nwyK (K:)
    mllpkrtkfrkqfrgrmtgdakggdyvafgdygliamepawiksnqieacrivmsrhfrr
    ggkiyirifpdkpvtkkpaetrmgkgkgaveywvsvvkpgrvmfevagvteeqakeafrl
    aghklpiqtkmvkrevydeaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nwyK (K:)
    tkfrkqfrgrmtgdakggdyvafgdygliamepawiksnqieacrivmsrhfrrggkiyi
    rifpdkpvtkkpaetrmgkgkgaveywvsvvkpgrvmfevagvteeqakeafrlaghklp
    iqtk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1nwyL (L:)
    mrhgkagrklnrnssarvalaraqatallregriqttltkakelrpfveqlittakggdl
    hsrrlvaqdihdkdvvrkvmdevapkyaerpggytrilrvgtrrgdgvtmalielv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nwyL (L:)
    hgkagrklnrnssarvalaraqatallregriqttltkakelrpfveqlittakggdlhs
    rrlvaqdihdkdvvrkvmdevapkyaerpggytrilrvgtrrgdgvtmalielv
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1nwyM (M:)
    atattirrklrtrrkvrtttaasgrlrlsvyrsskhiyaqiiddsrgqtlaaassaalks
    gnktdtaaavgkalaaaaaekgikqvvfdrgsykyhgrvkaladaareggldf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nwyM (M:)
    attirrklrtrrkvrtttaasgrlrlsvyrsskhiyaqiiddsrgqtlaaassaalksgn
    ktdtaaavgkalaaaaaekgikqvvfdrgsykyhgrvkaladaareggldf
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1nwyN (N:)
    mqthikinrgellrgieqdhtrqlpdfrpgdtvrvdtkvregnrtrsqafegvviaings
    gsrksftvrkisfgegvervfpfasplvnqvtivergkvrraklyylrelrgkaariksd
    rsrvmkdaaraqqdkanasasqaaaaqadvtvisaapevapetqge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nwyN (N:)
    qthikinrgellrgieqdhtrqlpdfrpgdtvrvdtkvregnrtrsqafegvviaingsg
    srksftvrkisfgegvervfpfasplvnqvtivergkvrraklyylrelrgkaariksdr
    srvmk
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1nwyO (O:)
    mpraktgivrrrrhkkvlkrakgfwgsrskqyrnafqtllnaatyeyrdrrnkkrdfrrl
    wiqrinagarlhgmnystfinglkranidlnrkvladiaarepeafkalvdasrnarq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nwyO (O:)
    praktgivrrrrhkkvlkrakgfwgsrskqyrnafqtllnaatyeyrdrrnkkrdfrrlw
    iqrinagarlhgmnystfinglkranidlnrkvladiaarepeafkalvdasrnarq
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nwyP (P:)
    mfaiiqtggkqyrvsegdvirveslqgeagdkvelkalfvggeqtvfgedagkytvqaev
    vehgrgkkiyirkyksgvqyrrrtghrqnftaikilgiqg
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1nwyQ (Q:)
    mtapeqtfrnkkqrkqqvklrkpgfavakyvrmsprkvrlvvdvirgksvqdaedllrfi
    prsasepvakvlnsakanalhndemledrlfvkeayvdagptlkrliprargsaniikkr
    tshitiivaekgnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nwyQ (Q:)
    eqtfrnkkqrkqqvklrkpgfavakyvrmsprkvrlvvdvirgksvqdaedllrfiprsa
    sepvakvlnsakanalhndemledrlfvkeayvdagptlkrliprargsaniikkrtshi
    tiivaekgnk
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1nwyR (R:)
    shydilqapvisekaysamergvysfwvspkatkteikdaiqqafgvrvigistmnvpgk
    rkrvgrfigqrndrkkaivrlaegqsiealagqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nwyR (R:)
    shydilqapvisekaysamergvysfwvspkatkteikdaiqqafgvrvigistmnvpgk
    rkrvgrfigqrndrkkaivrlaegqsiealagq
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1nwyS (S:)
    mprpsagshhndklhfkkgdtvivlsgkhkgqtgkvllalprdqkvvvegvnvitknvkp
    smtnpqggqeqrelalhaskvalvdpetgkatrvrkqivdgkkvrvavasgktid
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nwyS (S:)
    prpsagshhndklhfkkgdtvivlsgkhkgqtgkvllalprdqkvvvegvnvitknvkps
    mtnpqggqeqrelalhaskvalvdpetgkatrvrkqivdgkkvrvavasgkti
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1nwyT (T:)
    meltakprtpkqkldesmiaavaynkennvsfaldrkafdrafrqqsttglfditvegge
    tfpalvkavqmdkrkrapihvdfymvtygepvevsvpvhttgrsqgevqgglvdivvhnl
    qivapgprripqelvvdvtkmnigdhitagdiklpegctlaadpeltvvsvlpprltaee
    leaevqaaqvaglvaagelseeaaeavlegdasleevkaeasednagtdsednsdaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nwyT (T:)
    meltakprtpkqkldesmiaavaynkennvsfaldrkafdrafrqqsttglfditvegge
    tfpalvkavqmdkrkrapihvdfymvtygepvevsvpvhttgrsqgevqgglvdivvhnl
    qivapgprripqelvvdvtkmnigdhitagdiklpegctlaadpeltvvsvlpprltaee
    leaevqaaqvaglvaagelseeaaeavlegdasleevkaease
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >1nwyU (U:)
    mahkkgvgsskngrdsnpkylgvkkfggevvkagnilvrqrgtkfkagqgvgmgrdhtlf
    alsdgkvvfinkgkgarfisieaaqtevaad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nwyU (U:)
    ahkkgvgsskngrdsnpkylgvkkfggevvkagnilvrqrgtkfkagqgvgmgrdhtlfa
    lsdgkvvfinkgkgarfisieaaqte
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >1nwyW (W:)
    mkpsemrnlqatdfakeidarkkelmelrfqaaagqlaqphrvrqlrrevaqlntvkael
    arkgeqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nwyW (W:)
    kpsemrnlqatdfakeidarkkelmelrfqaaagqlaqphrvrqlrrevaqlntvkaela
    rkgeq
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nwyX (X:)
    mkiklvrsvigrpgnqvktvqalglrkigdsrevsdtpavrgmvktvkhllevqe
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nwyY (Y:)
    mqkdlhpkavpckiiyqgqvvmetmstrpeihvdvwsgvhpfwtgeerfldtegrvdkfn
    krfgdsyrrgskk
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >1nwyZ (Z:)
    akhpvpkkktskskrdmrrshhaltapnltecpqchgkklshhicpncgyydgrqvlav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nwyZ (Z:)
    akhpvpkkktskskrdmrrshhaltapnltecpqchgkklshhicpncgyydgrqvla