SCOP 1.71: Domain d1nwxe_: 1nwx E:

Lineage for d1nwxe_ (1nwx E:)

1. Root: SCOP 1.71

2. Class i: Low resolution protein structures [58117] (24 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.2: Large subunit [58124] (3 proteins)

6. Protein 50S subunit [58125] (3 species)

7. Species Deinococcus radiodurans [TaxId:1299] [69993] (15 PDB entries)

8. Domain d1nwxe_: 1nwx E: [86318]

Details for d1nwxe_

PDB Entry: 1nwx, 3.5 Å

PDB Description: complex of the large ribosomal subunit from deinococcus radiodurans with abt-773

SCOP Domain Sequences for d1nwxe_:

Sequence; same for both SEQRES and ATOM records:

>d1nwxe_ i.1.1.2 (E:) 50S subunit {Deinococcus radiodurans}
gkqpiavpsgvtvnaqdgvfkvkgpkgeltvpynteltvrqdgdqllverpsdaqkhral
hgltrtlvanavkgvsdgytinlelrgvgfrakltgkalemnigyshpviieppagvtfa
vpeptridvsgidkqlvgqvaanvrkvrkpdayhgkgvrfvgeqialkagkagatgg

Timeline for d1nwxe_:

• d1nwxe_ first appeared in SCOP 1.65
  
• d1nwxe_ appears in SCOP 1.69
  
• d1nwxe_ appears in SCOP 1.73
  
• d1nwxe_ appears in the current release, SCOPe 2.08