| Class i: Low resolution protein structures [58117] (24 folds) |
| Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
| Family i.1.1.2: Large subunit [58124] (3 proteins) |
| Protein 50S subunit [58125] (3 species) |
| Species Deinococcus radiodurans [TaxId:1299] [69993] (15 PDB entries) |
| Domain d1nwx3_: 1nwx 3: [86311] |
PDB Entry: 1nwx (more details), 3.5 Å
SCOP Domain Sequences for d1nwx3_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nwx3_ i.1.1.2 (3:) 50S subunit {Deinococcus radiodurans}
pkmkthkmakrrikitgtgkvmafksgkrhqntgksgdeirgkgkgfvlakaewarmklm
lpr
Timeline for d1nwx3_:
View in 3DDomains from other chains: (mouse over for more information) d1nwx0_, d1nwx1_, d1nwx2_, d1nwx4_, d1nwx9_, d1nwxa_, d1nwxb_, d1nwxc_, d1nwxd_, d1nwxe_, d1nwxf_, d1nwxg_, d1nwxh_, d1nwxi_, d1nwxj_, d1nwxk_, d1nwxl_, d1nwxm_, d1nwxn_, d1nwxo_, d1nwxp_, d1nwxq_, d1nwxr_, d1nwxs_, d1nwxt_, d1nwxu_, d1nwxw_, d1nwxx_, d1nwxy_, d1nwxz_ |