Lineage for d1nvvs_ (1nvv S:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 284893Fold a.117: Ras GEF [48365] (1 superfamily)
    multihelical
  4. 284894Superfamily a.117.1: Ras GEF [48366] (1 family) (S)
  5. 284895Family a.117.1.1: Ras GEF [48367] (1 protein)
  6. 284896Protein Son of sevenless protein homolog 1 (sos-1) [48368] (1 species)
  7. 284897Species Human (Homo sapiens) [TaxId:9606] [48369] (5 PDB entries)
  8. 284899Domain d1nvvs_: 1nvv S: [86279]
    Other proteins in same PDB: d1nvvq_, d1nvvr_
    complexed with gnp, mg, po4; mutant

Details for d1nvvs_

PDB Entry: 1nvv (more details), 2.18 Å

PDB Description: Structural evidence for feedback activation by RasGTP of the Ras-specific nucleotide exchange factor SOS

SCOP Domain Sequences for d1nvvs_:

Sequence, based on SEQRES records: (download)

>d1nvvs_ a.117.1.1 (S:) Son of sevenless protein homolog 1 (sos-1) {Human (Homo sapiens)}
qmrlpsadvyrfaepdseeniifeenmqpkagipiikagtviklierltyhmyadpnfvr
tflttyrsfckpqellsliierfeipepepteadriaiengdqplsaelkrfrkeyiqpv
qlrvlnvcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkiard
ngpghnitfqsspptvewhisrpghietfdlltlhpieiarqltllesdlyravqpselv
gsvwtkedkeinspnllkmirhttnltlwfekcivetenleervavvsriieilqvfqel
nnfngvlevvsamnsspvyrldhtfeqipsrqkkileeahelsedhykkylaklrsinpp
cvpffgiyltnilkteegnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpyclrves
dikrffenlnpmgnsmekeftdylfnksleieprnpkplprfpkkysyplkspgvrpsnp
r

Sequence, based on observed residues (ATOM records): (download)

>d1nvvs_ a.117.1.1 (S:) Son of sevenless protein homolog 1 (sos-1) {Human (Homo sapiens)}
qmrlpsadvyrfaepdseeniifeegipiikagtviklierltyhmyadpnfvrtfltty
rsfckpqellsliierfeipepepteadriaiengdqplsaelkrfrkeyiqpvqlrvln
vcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkiahnitfqss
pptvewhisrpghietfdlltlhpieiarqltllesdlyravqpselvgsvwtkedkein
spnllkmirhttnltlwfekcivetenleervavvsriieilqvfqelnnfngvlevvsa
mnsspvyrldhtfeqipsrqkkileeahelsedhykkylaklrsinppcvpffgiyltni
lkteegnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpyclrvesdikrffenlnpm
gnsmekeftdylfnksleieprnpkplprfpkkysyplkspgvrpsnpr

SCOP Domain Coordinates for d1nvvs_:

Click to download the PDB-style file with coordinates for d1nvvs_.
(The format of our PDB-style files is described here.)

Timeline for d1nvvs_: