Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (35 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein cH-p21 Ras protein [52593] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [52594] (42 PDB entries) |
Domain d1nvvq_: 1nvv Q: [86277] Other proteins in same PDB: d1nvvs_ |
PDB Entry: 1nvv (more details), 2.18 Å
SCOP Domain Sequences for d1nvvq_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nvvq_ c.37.1.8 (Q:) cH-p21 Ras protein {Human (Homo sapiens)} mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag qeeasamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
Timeline for d1nvvq_: